HPA014433

ZBTB7C antibody from Sigma-Aldrich
ZBTB36, ZNF857C
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014433
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014433, RRID:AB_1858966
Product name
Anti-ZBTB7C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014433
Antibody type
Polyclonal
Antigen
zinc finger and BTB domain containing 7C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EDDDDDTEDFADQENLPDPQDISCHQSPSKTDHLT
EKAYSDTPRDFPDSFQAGSPGHLGVIRDFSIESLL
RENLYPKANIPDRRPSLSPFAPDFFPHLWPGDFGA
FAQLPEQPMDSGPLDLVIKNRKIK
Storage
-20C
Provider Type Product Number
- No reagents -