HPA019332

WDR53 antibody from Sigma-Aldrich
MGC12928, MGC64882
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019332
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019332, RRID:AB_1858813
Product name
Anti-WDR53 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019332
Antibody type
Polyclonal
Antigen
WD repeat-containing protein 53 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VMLWSLQKARPLWITNLQEDETEEMEGPQSPGQLL
NPALAHSISVASCGNIFSCGAEDGKVRIFRVMGVK
CEQELGFKGHTSGVSQVCFLPESYLLLTGGNDGKI
TLWDANSEVEKKQKSPTKRTHRK
Storage
-20C
Provider Type Product Number
- No reagents -