HPA005761

ARMCX2 antibody from Sigma-Aldrich
ALEX2, GASP9, KIAA0512
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005761
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005761, RRID:AB_10600782
Product name
Anti-ARMCX2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005761
Antibody type
Polyclonal
Antigen
armadillo repeat containing, X-linked 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RDQTKKRMAKPKNRAVAGTGARARAGLRAGFTIDL
GSGFSPPTPVRAEAEDRAQDEASALDTVGAEAVAP
AASSAEAQSGAGSQAQEADGAGVGPKAESVVGAAM
ASAIAPPPGVTEALGAAEAPAMAGAPKVAEAPREA
ETSRA
Storage
-20C
Provider Type Product Number
- No reagents -