HPA013661

PPP1CC antibody from Sigma-Aldrich
PP1C, PP1gamma
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013661
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013661, RRID:AB_1855639
Product name
Anti-PPP1CC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013661
Antibody type
Polyclonal
Antigen
Serine/threonine-protein phosphatase PP1-gamma catalytic subunit recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPR
VASGLNPSIQKASNYRNNTVLYE
Storage
-20C
Provider Type Product Number
- No reagents -