HPA003747

TRIOBP antibody from Atlas Antibodies
DFNB28, HRIHFB2122, KIAA1662, TAP68, Tara

Antibody data

Product number
HPA003747
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003747, RRID:AB_1858328
Product name
Anti-TRIOBP
Provider product page
Atlas Antibodies - HPA003747
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EIGALMRQAEEREHTLRRCQQEGQELLRHNQELHG
RLSEEIDQLRGFIASQGMGNGCGRSNERSSCELEV
LLRVKENELQYLKKEVQCLRDELQMMQKDKRFTSG
KYQDVYVELSHIKTRSEREIEQLKEHLRL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.