HPA003747

TRIOBP antibody from Sigma-Aldrich
DFNB28, HRIHFB2122, KIAA1662, TAP68, Tara
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003747
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003747, RRID:AB_1858328
Product name
Anti-TRIOBP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003747
Antibody type
Polyclonal
Antigen
TRIO and F-actin-binding protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EIGALMRQAEEREHTLRRCQQEGQELLRHNQELHG
RLSEEIDQLRGFIASQGMGNGCGRSNERSSCELEV
LLRVKENELQYLKKEVQCLRDELQMMQKDKRFTSG
KYQDVYVELSHIKTRSEREIEQLKEHLRL
Storage
-20C
Provider Type Product Number
- No reagents -