HPA013650

MAGI2 antibody from Sigma-Aldrich
ACVRIP1, AIP1, ARIP1, KIAA0705, MAGI-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013650
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013650, RRID:AB_1853501
Product name
Anti-MAGI2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013650
Antibody type
Polyclonal
Antigen
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AEGKRKRNKSVSNMEKASIEPPEEEEEERPVVNGN
GVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQP
EELKEQMDDTKPTKPEDNEEPDPLPDNWEMA
Storage
-20C
Provider Type Product Number
- No reagents -