Antibody data

Product number
H00079837-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079837-M05, RRID:AB_1137371
Product name
PIP4K2C monoclonal antibody (M05), clone 3E10
Provider product page
Abnova Corporation - H00079837-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PIP4K2C.
Antigen sequence
DGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGP
GEFESFIDVYAIRSAEGAPQKEVYFMGLIDILTQY
DA
Isotype
IgG
Antibody clone number
3E10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -