HPA015641

USP7 antibody from Sigma-Aldrich
HAUSP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015641
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015641, RRID:AB_1858700
Product name
Anti-USP7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015641
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIM
VMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQ
AVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNF
MAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAW
DSK
Storage
-20C
Provider Type Product Number
- No reagents -