HPA015642

AFAP1 antibody from Sigma-Aldrich
AFAP, AFAP-110
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015642
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015642, RRID:AB_1844632
Product name
Anti-AFAP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015642
Antibody type
Polyclonal
Antigen
Actin filament-associated protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PEALHYDYIDVEMSASVIQTAKQTFCFMNRRVISA
NPYLGGTSNGYAHPSGTALHYDDVPCINGSLKGKK
PPVASNGVTGKGKTLSSQPKKADPAAVVKRTGSNA
AQYKYGKNRVEADAKR
Storage
-20C
Provider Type Product Number
- No reagents -