HPA015642

AFAP1 antibody from Atlas Antibodies
AFAP, AFAP-110
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015642
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015642, RRID:AB_1844632
Product name
Anti-AFAP1
Provider product page
Atlas Antibodies - HPA015642
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PEALHYDYIDVEMSASVIQTAKQTFCFMNRRVISA
NPYLGGTSNGYAHPSGTALHYDDVPCINGSLKGKK
PPVASNGVTGKGKTLSSQPKKADPAAVVKRTGSNA
AQYKYGKNRVEADAKR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -