HPA003729

RSPRY1 antibody from Atlas Antibodies
KIAA1972

Antibody data

Product number
HPA003729
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003729, RRID:AB_10964215
Product name
Anti-RSPRY1
Provider product page
Atlas Antibodies - HPA003729
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEP
PYSMITLHEMAETDEGWLDVVQSLIRVIPLEDPLG
PAVITLLLDECPLPTKDALQKLTEILNLNGEVACQ
DSSHPAKHRNTSAVLGCLAEKLAGPASIGLLSPGI
LEYLLQC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.