HPA014033

FUT11 antibody from Sigma-Aldrich
MGC33202
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014033
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014033, RRID:AB_1849192
Product name
Anti-FUT11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014033
Antibody type
Polyclonal
Antigen
Alpha-(1,3)-fucosyltransferase 11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MKYLAYKQPGGITNQFLLDSLKHREWGVNDPLLPN
YLNGFECFVCDYELARLDAEKAHAASPGDSPVFEP
HIAQPSHMDCPVPTPGFGNVEEIPENDSWKEMWLQ
DYWQGLDQGEALTAMIHNNETEQTKFWDYL
Storage
-20C
Provider Type Product Number
- No reagents -