H00023568-B01

ARL2BP antibody from Abnova Corporation
BART, BART1, RP66

Antibody data

Product number
H00023568-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023568-B01, RRID:AB_1203970
Product name
ARL2BP MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00023568-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ARL2BP protein.
Antigen sequence
MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDD
EFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYI
SLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVA
GDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLS
SGLVVTSLCKSSSLPASQNNLRH
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -