HPA015643

KANK2 antibody from Sigma-Aldrich
ANKRD25, KIAA1518, MXRA3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015643
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015643, RRID:AB_1844839
Product name
Anti-KANK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015643
Antibody type
Polyclonal
Antigen
KN motif and ankyrin repeat domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SQHIPTAEGASGSNTEEEIRMELSPDLISACLALE
KYLDNPNALTERELKVAYTTVLQEWLRLACRSDAH
PELVRRHLVTFRAMSARLLDYVVNIADSNGNTALH
YSVSHANFPVVQ
Storage
-20C
Provider Type Product Number
- No reagents -