HPA029569

RANBP17 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029569
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029569, RRID:AB_10601571
Product name
Anti-RANBP17 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029569
Antibody type
Polyclonal
Antigen
RAN binding protein 17 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVLMYVLTSISEGLTTLDTVVSSSCCTSLDYIVTY
LFKHIAKEGKKPLRCREATQAGQRLLHFMQQNPDV
LQQMMSVLMNTIVFEDCRNQWSVS
Storage
-20C
Provider Type Product Number
- No reagents -