Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057019-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057019-M01, RRID:AB_530002
- Product name
- CIAPIN1 monoclonal antibody (M01), clone 5G8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CIAPIN1.
- Antigen sequence
DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKA
CKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLG
DAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA- Isotype
- IgG
- Antibody clone number
- 5G8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CIAPIN1 monoclonal antibody (M01), clone 5G8 Western Blot analysis of CIAPIN1 expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CIAPIN1 monoclonal antibody (M01), clone 5G8. Western Blot analysis of CIAPIN1 expression in Raw 264.7(Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CIAPIN1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol