ABIN629634

antibody from antibodies-online

Targeting: RNF38

Western blot

Antibody data

Submit

Validation data

Product number: ABIN629634 - Provider product page
Provider: antibodies-online
Product name: anti-Ring Finger Protein 38 (RNF38) (N-Term) antibody
Antibody type: Polyclonal
Antigen: RNF38 antibody was raised using the N terminal of RNF38 corresponding to a region with amino acids FDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSP
Description: Purified
Reactivity: Human
Host: Rabbit
Epitope: N-Term
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

RNF38 protein structure - ABIN629634 shown in red.