Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310449 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Ring Finger Protein 38 (RNF38) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RNF38 antibody: synthetic peptide directed towards the N terminal of human RNF38
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Xenopus
- Host
- Rabbit
- Antigen sequence
FDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHF
SGERC NTPARNRRSP- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France.
Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
Lazrek M, Goffard A, Schanen C, Karquel C, Bocket L, Lion G, Devaux M, Hedouin V, Gosset D, Hober D
Diagnostic microbiology and infectious disease 2006 May;55(1):55-8
Diagnostic microbiology and infectious disease 2006 May;55(1):55-8
Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
Kimura K, Wakamatsu A, Suzuki Y, Ota T, Nishikawa T, Yamashita R, Yamamoto J, Sekine M, Tsuritani K, Wakaguri H, Ishii S, Sugiyama T, Saito K, Isono Y, Irie R, Kushida N, Yoneyama T, Otsuka R, Kanda K, Yokoi T, Kondo H, Wagatsuma M, Murakawa K, Ishida S, Ishibashi T, Takahashi-Fujii A, Tanase T, Nagai K, Kikuchi H, Nakai K, Isogai T, Sugano S
Genome research 2006 Jan;16(1):55-65
Genome research 2006 Jan;16(1):55-65
No comments: Submit comment
No validations: Submit validation data