HPA015853

RNF38 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015853
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015853, RRID:AB_1856365
Product name
Anti-RNF38 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015853
Antibody type
Polyclonal
Antigen
RING finger protein 38 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVFSGQHLPVCSVPPPMLQACSVQHLPVPYAAFPP
LISSDPFLIHPPHLSPHHPPHLPPPGQFVPFQTQQ
SRSPLQRIENEVELLGEHLPVGGFTYPPSAHPPTL
PPSAPL
Storage
-20C
Provider Type Product Number
- No reagents -