HPA011078

HLA-DPB1 antibody from Sigma-Aldrich
HLA-DP1B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011078
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011078, RRID:AB_1079378
Product name
Anti-HLA-DPB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011078
Antibody type
Polyclonal
Antigen
HLA class II histocompatibility antigen, DP(W4) beta-chain precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKD
ILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNV
SPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
EETAGVVSTNLIRNGDWTF
Storage
-20C
Provider Type Product Number
- No reagents -