Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29490 - Provider product page

- Provider
- Abnova Corporation
- Product name
- ENTPD1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- ENTPD1 polyclonal antibody raised against recombinant human ENTPD1.
- Antigen sequence
GVVHQVEECRVKGPGISKFVQKVNEIGIYLTDCME
RAREVIPRSQHQETPVYLGATAGMRLLRMESEELA
DRVLDVVERSLSNYPFDFQGARIITGQEEGAYGWI
TINYLLGKFSQKTRWFS- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot (Cell lysate) analysis of Lane 1: RT-4 cell lysate, Lane 2: U-251 MG sp cell lysate with ENTPD1 polyclonal antibody (Cat# PAB29490) at 1:100 - 1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of U-251 MG cells with ENTPD1 polyclonal antibody (Cat# PAB29490) under 1-4 ug/mL working concentration shows positivity in microtubules. Antibody staining is shown in green.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human placenta with ENTPD1 polyclonal antibody (Cat# PAB29490) shows strong cytoplasmic positivity in trophoblastic cells at 1:50 - 1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)