HPA014067

ENTPD1 antibody from Sigma-Aldrich
ATPDase, CD39, NTPDase-1, SPG64
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014067
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014067, RRID:AB_1848178
Product name
Anti-ENTPD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014067
Antibody type
Polyclonal
Antigen
Ectonucleoside triphosphate diphosphohydrolase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GVVHQVEECRVKGPGISKFVQKVNEIGIYLTDCME
RAREVIPRSQHQETPVYLGATAGMRLLRMESEELA
DRVLDVVERSLSNYPFDFQGARIITGQEEGAYGWI
TINYLLGKFSQKTRWFS
Storage
-20C
Provider Type Product Number
- No reagents -