Antibody data

Product number
H00009376-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009376-M02, RRID:AB_1204983
Product name
SLC22A8 monoclonal antibody (M02), clone 3C11
Provider product page
Abnova Corporation - H00009376-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SLC22A8.
Antigen sequence
TPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGE
RLSLEELKLNLQKEISLAKAKYTASDLFRIPMLRR
Isotype
IgG
Antibody clone number
3C11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -