H00010209-M01A

EIF1 antibody from Abnova Corporation
A121, EIF-1, EIF1A, ISO1, SUI1
No application information provided.

Antibody data

Product number
H00010209-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010209-M01A, RRID:AB_1204306
Product name
EIF1 monoclonal antibody (M01A), clone 2E1
Provider product page
Abnova Corporation - H00010209-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant EIF1.
Antigen sequence
MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRI
QQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACN
GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKD
DQLKVHGF
Isotype
IgM
Antibody clone number
2E1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -