HPA003936

CCDC134 antibody from Sigma-Aldrich
FLJ22349
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003936
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003936, RRID:AB_1078419
Product name
Anti-CCDC134 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003936
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 134 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSR
TVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFG
DVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTG
VFNQGPHSPILSLMAQEL
Storage
-20C
Provider Type Product Number
- No reagents -