Explore
Validate
Learn
Western blot
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183359 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Annexin A3 (ANXA3) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ANXA3 antibody: synthetic peptide directed towards the N terminal of human ANXA3
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Canine
- Host
- Rabbit
- Antigen sequence
MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIG
TDEKM LISILTERSN- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Nephrotic syndrome and subepithelial deposits in a mouse model of immune-mediated anti-podocyte glomerulonephritis.
Primary cell cultures from human renal cortex and renal-cell carcinoma evidence a differential expression of two spliced isoforms of Annexin A3.
Alterations of the podocyte proteome in response to high glucose concentrations.
Combined analysis of transcriptome and proteome data as a tool for the identification of candidate biomarkers in renal cell carcinoma.
Dissociation of cyclic inositol phosphohydrolase activity from annexin III.
Meyer-Schwesinger C, Dehde S, Klug P, Becker JU, Mathey S, Arefi K, Balabanov S, Venz S, Endlich KH, Pekna M, Gessner JE, Thaiss F, Meyer TN
Journal of immunology (Baltimore, Md. : 1950) 2011 Sep 15;187(6):3218-29
Journal of immunology (Baltimore, Md. : 1950) 2011 Sep 15;187(6):3218-29
Primary cell cultures from human renal cortex and renal-cell carcinoma evidence a differential expression of two spliced isoforms of Annexin A3.
Bianchi C, Bombelli S, Raimondo F, Torsello B, Angeloni V, Ferrero S, Di Stefano V, Chinello C, Cifola I, Invernizzi L, Brambilla P, Magni F, Pitto M, Zanetti G, Mocarelli P, Perego RA
The American journal of pathology 2010 Apr;176(4):1660-70
The American journal of pathology 2010 Apr;176(4):1660-70
Alterations of the podocyte proteome in response to high glucose concentrations.
Schordan S, Schordan E, Endlich N, Lindenmeyer MT, Meyer-Schwesinger C, Meyer TN, Giebel J, Cohen CD, Endlich K, Maurer MH
Proteomics 2009 Oct;9(19):4519-28
Proteomics 2009 Oct;9(19):4519-28
Combined analysis of transcriptome and proteome data as a tool for the identification of candidate biomarkers in renal cell carcinoma.
Seliger B, Dressler SP, Wang E, Kellner R, Recktenwald CV, Lottspeich F, Marincola FM, Baumgärtner M, Atkins D, Lichtenfels R
Proteomics 2009 Mar;9(6):1567-81
Proteomics 2009 Mar;9(6):1567-81
Dissociation of cyclic inositol phosphohydrolase activity from annexin III.
Sekar MC, Sambandam V, Grizzle WE, McDonald JM
The Journal of biological chemistry 1996 Apr 5;271(14):8295-9
The Journal of biological chemistry 1996 Apr 5;271(14):8295-9
No comments: Submit comment
No validations: Submit validation data