HPA013398

ANXA3 antibody from Sigma-Aldrich
ANX3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013398
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013398, RRID:AB_1844861
Product name
Anti-ANXA3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013398
Antibody type
Polyclonal
Antigen
Annexin A3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ISQAYYTVYKKSLGDDISSETSGDFRKALLTLADG
RRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKF
TEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGEL
SGHFEDLLLAIVNCVRNTPAFLAERLHRALKGIGT
D
Storage
-20C
Provider Type Product Number
- No reagents -