Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [4]
- Immunocytochemistry [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA013398 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA013398, RRID:AB_1844861
- Product name
- Anti-ANXA3
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ISQAYYTVYKKSLGDDISSETSGDFRKALLTLADG
RRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKF
TEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGEL
SGHFEDLLLAIVNCVRNTPAFLAERLHRALKGIGT
D- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Differential Protein Expression Profiles of Cyst Fluid from Papillary Thyroid Carcinoma and Benign Thyroid Lesions
Dinets A, Pernemalm M, Kjellin H, Sviatoha V, Sofiadis A, Juhlin C, Zedenius J, Larsson C, Lehtiö J, Höög A, Dumont J
PLOS ONE 2015 May;10(5)
PLOS ONE 2015 May;10(5)
No comments: Submit comment
Supportive validation
Supportive validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines A-431 and HEK293 using Anti-ANXA3 antibody. Corresponding ANXA3 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-ANXA3 antibody HPA013398 (A) shows similar pattern to independent antibody HPA013431 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line CACO-2.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human bone marrow and testis tissues using Anti-ANXA3 antibody. Corresponding ANXA3 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells of tubules and Bowmans capsule.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human bone marrow shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows low expression as expected.
- Sample type
- HUMAN