HPA013398

ANXA3 antibody from Atlas Antibodies
ANX3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA013398
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA013398, RRID:AB_1233457
Product name
Anti-ANXA3
Provider product page
Atlas Antibodies - HPA013398
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ISQAYYTVYKKSLGDDISSETSGDFRKALLTLADG
RRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKF
TEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGEL
SGHFEDLLLAIVNCVRNTPAFLAERLHRALKGIGT
D
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -