HPA014055

IQGAP1 antibody from Sigma-Aldrich
HUMORFA01, KIAA0051, p195, SAR1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014055
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014055, RRID:AB_1851856
Product name
Anti-IQGAP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014055
Antibody type
Polyclonal
Antigen
Ras GTPase-activating-like protein IQGAP1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NRALESGDVNTVWKQLSSSVTGLTNIEEENCQRYL
DELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQ
EEHERILAIGLINEALDEGDAQKTLQALQIPAAKL
EGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWL
DEIQGG
Storage
-20C
Provider Type Product Number
- No reagents -