H00123920-B01P

CMTM3 antibody from Abnova Corporation
BNAS2, CKLFSF3, FLJ31762

Antibody data

Product number
H00123920-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00123920-B01P, RRID:AB_1573088
Product name
CMTM3 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00123920-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CMTM3 protein.
Antigen sequence
MWPPDPDPDPDPEPAGGSRPGPAVPGLRALLPARA
FLCSLKGRLLLAESGLSFITFICYVASSASAFLTA
PLLEFLLALYFLFADAMQLNDKWQGLCWPMMDFLR
CVTAALIYFAISITAIAKYSDGASKAAGVFGFFAT
IVFATDFYLIFNDVAKFLKQGDSADETTAHKTEEE
NSDSDSD
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -