HPA017657

TMSB15A antibody from Sigma-Aldrich
TMSL8, TMSNB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017657
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017657, RRID:AB_1858153
Product name
Anti-TMSB15B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017657
Antibody type
Polyclonal
Antigen
NB thymosin beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKEKL
HYVRYGKRESEYADIRSKKPSFLPVVCQ
Storage
-20C
Provider Type Product Number
- No reagents -