HPA013572

ZCCHC14 antibody from MilliporeSigma / Merck KGaA
BDG29, MGC14139
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013572
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA013572, RRID:AB_1858979
Product name
Anti-ZCCHC14 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA013572
Antibody type
Polyclonal
Antigen
Zinc finger CCHC domain-containing protein 14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IHLESSDKEKPVMLLNHFTSSSARPTAQVLPVQNE
ASSNPSGHHPLPPQMLSAASHITPIRMLNSVHKPE
RGSADMKLLSSSVHSLLSLEERNKGSGPRSSMKVD
Storage
-20C
Provider Type Product Number
- No reagents -