H00006257-M12

RXRB antibody from Abnova Corporation
H-2RIIBP, NR2B2, RCoR-1

Antibody data

Product number
H00006257-M12
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006257-M12, RRID:AB_1204943
Product name
RXRB monoclonal antibody (M12), clone 1H1
Provider product page
Abnova Corporation - H00006257-M12
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RXRB.
Antigen sequence
QINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPP
GGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFK
RTIRKDLTYSCRDNKDCTVDKRQRNRCQYC
Isotype
IgG
Antibody clone number
1H1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -