H00006257-M11

RXRB antibody from Abnova Corporation
H-2RIIBP, NR2B2, RCoR-1

Antibody data

Product number
H00006257-M11
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006257-M11, RRID:AB_1580321
Product name
RXRB monoclonal antibody (M11), clone 2G3
Provider product page
Abnova Corporation - H00006257-M11
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RXRB.
Antigen sequence
QINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPP
GGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFK
RTIRKDLTYSCRDNKDCTVDKRQRNRCQYC
Isotype
IgG
Antibody clone number
2G3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -