HPA027813

RSC1A1 antibody from MilliporeSigma / Merck KGaA
RS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027813
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027813, RRID:AB_10600308
Product name
Anti-RSC1A1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027813
Antibody type
Polyclonal
Antigen
regulatory solute carrier protein, family 1, member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEKSAERSTQGLKFHLHTRQEASLSVTSTRMHEPQ
MFLGEKDWHPENQNLSQVSDPQQHEEPGNEQYEVA
QQKASHDQEYLCNIGDLELPEERQQNQHKI
Storage
-20C
Provider Type Product Number
- No reagents -