H00025895-B01

EEF1AKMT3 antibody from Abnova Corporation
DKFZP586D0919, FAM119B, METTL21B

Antibody data

Product number
H00025895-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00025895-B01, RRID:AB_1204274
Product name
DKFZP586D0919 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00025895-B01
Antibody type
Polyclonal
Antigen
DKFZP586D0919 (NP_056248.2, 1 a.a. ~ 226 a.a) full-length human protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MADPGPDPESESESVFPREVGLFADSYSEKSQFCF
CGHVLTITQNFGSRLGVAARVWDAALSLCNYFESQ
NVDFRGKKVIELGAGTGIVGILAALQGGDVTITDL
PLALEQIQGNVQANVPAGGQAQVRALSWGIDHHVF
PANYDLVLGADIVYLEPTFPLLLGTLQHLCRPHGT
IYLASKMRKEHGTESFFQHLLPQHFQLELAQRDED
ENVNIYRARHREPRPA
Vial size
50 µl
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -