H00023671-M08

TMEFF2 antibody from Abnova Corporation
CT120.2, HPP1, TENB2, TPEF, TR
No application information provided.

Antibody data

Product number
H00023671-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023671-M08, RRID:AB_1205087
Product name
TMEFF2 monoclonal antibody (M08), clone 1D12
Provider product page
Abnova Corporation - H00023671-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TMEFF2.
Antigen sequence
SYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTT
KSEDGHYARTDYAENANKLEESAREHHIPCPEHYN
GFCMHGKCEHSINMQEPSCRCD
Isotype
IgG
Antibody clone number
1D12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -