HPA015587

TMEFF2 antibody from Sigma-Aldrich
CT120.2, HPP1, TENB2, TPEF, TR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015587
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015587, RRID:AB_1858069
Product name
Anti-TMEFF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015587
Antibody type
Polyclonal
Antigen
Tomoregulin-2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCK
FDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESY
QNECYLRQAACKQQSEILVVSEGSCATDAGSGSGD
GVHEGSGETSQKETSTCDICQFGAECDEDA
Storage
-20C
Provider Type Product Number
- No reagents -