Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001482-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001482-M04, RRID:AB_837482
- Product name
- NKX2-5 monoclonal antibody (M04), clone 3C1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant NKX2-5.
- Antigen sequence
MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSA
RLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELR
AELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKD
PRAEKKELCALQKAVELEKTEADNA*- Isotype
- IgG
- Antibody clone number
- 3C1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of NKX2-5 expression in transfected 293T cell line by NKX2-5 monoclonal antibody (M04), clone 3C1.Lane 1: NKX2-5 transfected lysate(34.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to NKX2-5 on HeLa cell . [antibody concentration 15 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of NKX2-5 transfected lysate using anti-NKX2-5 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NKX2-5 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol