Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001482-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001482-M01, RRID:AB_425386
- Product name
- NKX2-5 monoclonal antibody (M01), clone 1E4-G5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant NKX2-5.
- Antigen sequence
MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSA
RLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELR
AELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKD
PRAEKKELCALQKAVELEKTEADNAERPRARRRRK
PRVLFSQAQVYELERRFKQQRYLSAPERDQLASVL
KLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPP
PPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGL
NPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSP
AQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGV
STLHGIRAW- Isotype
- IgG
- Antibody clone number
- 1E4-G5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Complex SUMO-1 regulation of cardiac transcription factor Nkx2-5.
RNA toxicity in myotonic muscular dystrophy induces NKX2-5 expression.
Costa MW, Lee S, Furtado MB, Xin L, Sparrow DB, Martinez CG, Dunwoodie SL, Kurtenbach E, Mohun T, Rosenthal N, Harvey RP
PloS one 2011;6(9):e24812
PloS one 2011;6(9):e24812
RNA toxicity in myotonic muscular dystrophy induces NKX2-5 expression.
Yadava RS, Frenzel-McCardell CD, Yu Q, Srinivasan V, Tucker AL, Puymirat J, Thornton CA, Prall OW, Harvey RP, Mahadevan MS
Nature genetics 2008 Jan;40(1):61-8
Nature genetics 2008 Jan;40(1):61-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NKX2-5 monoclonal antibody (M01), clone 1E4-G5. Western Blot analysis of NKX2-5 expression in human thyroid(diffuse hyperplasia).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NKX2-5 monoclonal antibody (M01), clone 1E4-G5 Western Blot analysis of NKX2-5 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of NKX2-5 expression in transfected 293T cell line by NKX2-5 monoclonal antibody (M01), clone 1E4-G5.Lane 1: NKX2-5 transfected lysate(34.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NKX2-5 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol