Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406448 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-SPO11 Meiotic Protein Covalently Bound To DSB Homolog (S. Cerevisiae) (SPO11) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SPO11 antibody: synthetic peptide directed towards the N terminal of human SPO11
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
KFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLF
GNQTV VDNIINDISC- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Genetic investigation of four meiotic genes in women with premature ovarian failure.
Mandon-Pépin B, Touraine P, Kuttenn F, Derbois C, Rouxel A, Matsuda F, Nicolas A, Cotinot C, Fellous M
European journal of endocrinology / European Federation of Endocrine Societies 2008 Jan;158(1):107-15
European journal of endocrinology / European Federation of Endocrine Societies 2008 Jan;158(1):107-15
No comments: Submit comment
No validations: Submit validation data