H00060681-M02
antibody from Abnova Corporation
Targeting: FKBP10
FKBP6, FKBP65, FLJ20683, FLJ22041, FLJ23833, hFKBP65
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00060681-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00060681-M02, RRID:AB_1574883
- Product name
- FKBP10 monoclonal antibody (M02), clone 3B5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FKBP10.
- Antigen sequence
ADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLL
DGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGM
CVGERRQLIVPPHLAHGESGARGV- Isotype
- IgG
- Antibody clone number
- 3B5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A novel splicing mutation in FKBP10 causing osteogenesis imperfecta with a possible mineralization defect.
Venturi G, Monti E, Dalle Carbonare L, Corradi M, Gandini A, Valenti MT, Boner A, Antoniazzi F
Bone 2012 Jan;50(1):343-9
Bone 2012 Jan;50(1):343-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- FKBP10 monoclonal antibody (M02), clone 3B5. Western Blot analysis of FKBP10 expression in HepG2(Cat # L019V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged FKBP10 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol