Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008614-M08 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008614-M08, RRID:AB_566209
- Product name
- STC2 monoclonal antibody (M08), clone 2B11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant STC2.
- Antigen sequence
MCAERLGQFMTLALVLATFDPARGTDATNPPEGPQ
DRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFEC
FENNSCEIRGLHGICMTFLHNAGKFDAQGKSFIKD
ALKCKAHALRHRFGCISRKCPAIREMVSQLQRECY
LKHDLCAAAQENTRVIVEMIHFKDLLLHEPYVDLV
NLLLTCGEEVKEAITHSVQVQCEQNWGSLCSILSF
CTSAIQKPPTAPPERQPQVDRTKLSRAHHGEAGHH
LPEPSSRETGRGAKGERGSKSHPNAHARGRVGGLG
AQGPSGSSEWEDEQSEYSDIRR- Isotype
- IgG
- Antibody clone number
- 2B11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Stanniocalcin-2 (STC2): A potential lung cancer biomarker promotes lung cancer metastasis and progression.
Anti-VEGF antibody therapy induces tumor hypoxia and stanniocalcin 2 expression and potentiates growth of human colon cancer xenografts.
STC2: a predictive marker for lymph node metastasis in esophageal squamous-cell carcinoma.
Clinical significance of stanniocalcin 2 as a prognostic marker in gastric cancer.
Na SS, Aldonza MB, Sung HJ, Kim YI, Son YS, Cho S, Cho JY
Biochimica et biophysica acta 2015 Jun;1854(6):668-76
Biochimica et biophysica acta 2015 Jun;1854(6):668-76
Anti-VEGF antibody therapy induces tumor hypoxia and stanniocalcin 2 expression and potentiates growth of human colon cancer xenografts.
Miyazaki S, Kikuchi H, Iino I, Uehara T, Setoguchi T, Fujita T, Hiramatsu Y, Ohta M, Kamiya K, Kitagawa K, Kitagawa M, Baba S, Konno H
International journal of cancer 2014 Jul 15;135(2):295-307
International journal of cancer 2014 Jul 15;135(2):295-307
STC2: a predictive marker for lymph node metastasis in esophageal squamous-cell carcinoma.
Kita Y, Mimori K, Iwatsuki M, Yokobori T, Ieta K, Tanaka F, Ishii H, Okumura H, Natsugoe S, Mori M
Annals of surgical oncology 2011 Jan;18(1):261-72
Annals of surgical oncology 2011 Jan;18(1):261-72
Clinical significance of stanniocalcin 2 as a prognostic marker in gastric cancer.
Yokobori T, Mimori K, Ishii H, Iwatsuki M, Tanaka F, Kamohara Y, Ieta K, Kita Y, Doki Y, Kuwano H, Mori M
Annals of surgical oncology 2010 Oct;17(10):2601-7
Annals of surgical oncology 2010 Oct;17(10):2601-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- STC2 monoclonal antibody (M08), clone 2B11. Western Blot analysis of STC2 expression in PC-12.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged STC2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol