HPA017762

KLHL8 antibody from Atlas Antibodies
KIAA1378
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017762
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017762, RRID:AB_2669660
Product name
Anti-KLHL8
Provider product page
Atlas Antibodies - HPA017762
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HFHPSNCLAVRAFAESHNRIDLMDMADQYACDHFT
EVVECEDFVSVSPQHLHKLLSSSDLNIENEKQVYN
AAIKWLLANPQHHSKWLDETLAQVRLPLLPVDFLM
GVVAKEQIVKQNLKCRDLLDEARNYHL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -