HPA013856

KLHL8 antibody from Sigma-Aldrich
KIAA1378
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013856
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013856, RRID:AB_1852594
Product name
Anti-KLHL8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013856
Antibody type
Polyclonal
Antigen
Kelch-like protein 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VISVEGKVYAVGGHDGNEHLGSMEMFDPLTNKWMM
KASMNTKRRGIALASLGGPIYAIGGLDDNTCFNDV
ERYDIESDQWSTVAPMNTPRGGVGSVALVNHVYAV
GGNDGMASLSSVE
Storage
-20C
Provider Type Product Number
- No reagents -