H00007923-B01

HSD17B8 antibody from Abnova Corporation
D6S2245E, FABGL, H2-KE6, HKE6, KE6, RING2, SDR30C1

Antibody data

Product number
H00007923-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007923-B01, RRID:AB_913229
Product name
HSD17B8 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00007923-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human HSD17B8 protein.
Antigen sequence
MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEG
ATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHA
AFQADVSEARAARCLLEQVQACFSRPPSVVVSCAG
ITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQ
ALVSNGCRGSIINISSIVGKVGNVGQINYAASKAG
VIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKV
PQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDS
GYITGTSVEVTGGLFM
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -