H00011145-D01
antibody from Abnova Corporation
Targeting: PLAAT3
AdPLA, H-REV107-1, HRASLS3, HREV107, HREV107-3, MGC118754., PLA2G16, PLAAT-3
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011145-D01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011145-D01, RRID:AB_10731439
- Product name
- PLA2G16 MaxPab rabbit polyclonal antibody (D01)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human PLA2G16 protein.
- Antigen sequence
MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVH
LAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAG
SDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVL
YKLTSENCEHFVNELRYGVARSDQVRDVIIAASVA
GMGLAAMSLIGVMFSRNKRQKQ- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of PLA2G16 expression in transfected 293T cell line (H00011145-T02) by PLA2G16 MaxPab polyclonal antibody.Lane 1: PLA2G16 transfected lysate(17.9 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PLA2G16 MaxPab rabbit polyclonal antibody. Western Blot analysis of PLA2G16 expression in NIH/3T3.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PLA2G16 MaxPab rabbit polyclonal antibody. Western Blot analysis of PLA2G16 expression in human spleen.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of purified MaxPab antibody to PLA2G16 on HeLa cell. [antibody concentration 30 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of PLA2G16 transfected lysate using anti-PLA2G16 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PLA2G16 purified MaxPab mouse polyclonal antibody (B01P) (H00011145-B01P).
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol