H00011145-D01

PLAAT3 antibody from Abnova Corporation
AdPLA, H-REV107-1, HRASLS3, HREV107, HREV107-3, MGC118754., PLA2G16, PLAAT-3

Antibody data

Product number
H00011145-D01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00011145-D01, RRID:AB_10731439
Product name
PLA2G16 MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00011145-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human PLA2G16 protein.
Antigen sequence
MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVH
LAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAG
SDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVL
YKLTSENCEHFVNELRYGVARSDQVRDVIIAASVA
GMGLAAMSLIGVMFSRNKRQKQ
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -