HPA006433

MYRIP antibody from Sigma-Aldrich
DKFZp586F1018, exophilin-8, MyRIP, SLAC2-C, SLAC2C
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006433
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006433, RRID:AB_10603023
Product name
Anti-MYRIP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006433
Antibody type
Polyclonal
Antigen
myosin VIIA and Rab interacting protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SALPSWKSVDRLDETNLAPVLQSPDGNWVALKDGA
PPPTRLLAKPKSGTFQALEVASSVASAYDEMGSDS
EEDFDWSEALSKLCPRSRALPRNPQPQPTQAQSSD
QGPIAASPSSALSPNPEAMCSDSETSSAGSSR
Storage
-20C
Provider Type Product Number
- No reagents -